| Product name: | Human FDP antigen |
|---|---|
| Synonym: | Human FDP Antigen, Human FDP recombinant protein, Human FDP protein antigen, Human FDP Diagnostic antigen, Human FDP diagnostic reagent |
| Product Type: | Native protein antigen |
| Product Category: | Cardiac Markers |
| Catalog: | AG10026 |
| Qty/Pack Size: | 100ug, 1mg |
| Format: | Purified Recombinant Antigen. |
| Source: | Human |
| Express Host: | Native |
| Purity: | >95% |
| Supplied In: | 10 mM Phosphate Buffer, 150 mM Sodium Chloride, pH 7.4 |
| Applications: | ELISA, WB, Immunogen, Lateral Flow, CMIA |
| Storage: |
Short Term (≤ 2 weeks): 2-8°C. Long Term: -20°C. Avoid repeated freezing and thawing.
Recombinant proteins are provided as frozen liquid which are shipped with dry ice.
Bulk packages canbeprovided as lyophilized powder which shipped with blue ice. |
| Molecular Mass: | The protein of Human FDP consists of 128 amino acids. |
| Biological Activity: | N/A |
| Endotoxin | N/A |
| Gene sequence: |
AF243505.1, Homo sapiens fibrocyte-derived protein (FDP) mRNA, complete cds
|
| Protein sequence: | AAG42356.1, fibrocyte-derived protein [Homo sapiens] |
| Discription: | The content of FDP can reflect the strength of fibrinolytic activity in vivo.FDP can inhibit fibrin formation, antithrombin, and inhibit platelet adhesion, aggregation and release. |
| Sequence: |
MARILLLFLPGLVAVCAVHGIFMDRLASKKLCADDECVYTISLA
SAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYG
DGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE
|
| SDS Page: | -- |
| Note: | This product is intended for research and manufacturing uses only. It is not a diagnostic device. The user assumes all responsibility for care, custody and control of the material, including its disposal, in accordance with all regulations. |
Customers Navigation
Product Infomation
- Previous：D-dimer Antigen
- Next：ST2 Antigen