| Product name: | Human H-FABP antigen |
|---|---|
| Synonym: | Human H-FABP Antigen, Human H-FABP recombinant protein, Human H-FABP protein antigen, Human H-FABP Diagnostic antigen, Human H-FABP diagnostic reagent, Human FABP3 Antigen, Human FABP3 recombinant protein, Human FABP3 protein antigen, Human FABP3 Diagnostic antigen, Human FABP3 diagnostic reagent, FABP11; H-FABP; M-FABP; MDGI; O-FABP |
| Product Type: | Recombinant protein antigen |
| Product Category: | Cardiac Markers |
| Catalog: | AG10023 |
| Qty/Pack Size: | 100ug, 1mg |
| Format: | Purified Recombinant Antigen. |
| Source: | Human |
| Express Host: | E.coli |
| Purity: | >95% |
| Supplied In: | 10 mM Phosphate Buffer, 150 mM Sodium Chloride, pH 7.4 |
| Applications: | ELISA, WB, Immunogen, Lateral Flow, CMIA |
| Storage: |
Short Term (≤ 2 weeks): 2-8°C. Long Term: -20°C. Avoid repeated freezing and, thawing.
Recombinant proteins are provided as frozen liquid which are shipped with dry ice.
Bulk packages canbeprovided as lyophilized powder which shipped with blue ice. |
| Construction: | A DNA sequence encoding the Human H-FABP Protein was expressed with His-tag in N terminus. |
| Molecular Mass: | The protein of Human H-FABP consists of 132 amino acids. |
| Biological Activity: | N/A |
| Endotoxin | N/A |
| Gene ID: | 2170 |
| Gene sequence: |
NM_001320996.2, Homo sapiens fatty acid binding protein 3 (FABP3), transcript variant 1, mRNA
|
| Protein sequence: | NP_001307925.1, fatty acid-binding protein, heart isoform 1 [Homo sapiens] |
| Discription: | Fatty acid binding proteins (FABPs) are proteins responsible for the movement of fatty acids and lipopilesubstances into and out of cells. They are classified as liver, gut, heart, adipocyte, epidermal, ileum, brain, myelin and testicular FABPs.Cardiotype FABP (H-FABP) is found primarily in the heart and is rapidly releasedinto the circulatory system when ischemic injury occurs to the myocardium, which is then eliminatedbythekidneys.H-FABP has been used clinically as a marker to assess subclinical ischemia and predict possibledisease progression. |
| Sequence: |
HHHHHHMVDAFLGTWKLVDSKNFDDYMKSLAHILITFPLPSGVGFATRQV
ASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSI
VTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKE
|
| SDS Page: | -- |
| Note: | This product is intended for research and manufacturing uses only. It is not a diagnostic device. The user assumes all responsibility for care, custody and control of the material, including its disposal, in accordance with all regulations. |
Customers Navigation
FABP3 Product Infomation
- Previous：CK-MB Antigen
- Next：Lp-PLA2 Antigen