| Product name: | Human Lp-PLA2 antigen |
|---|---|
| Synonym: |
Human Lp-PLA2 Antigen, Human Lp-PLA2 recombinant protein, Human Lp-PLA2 protein antigen, Human Lp-PLA2 Diagnostic antigen, Human Lp-PLA2 diagnostic reagent, Human PLA2G7 Antigen, Human PLA2G7 recombinant protein, Human PLA2G7 protein antigen, Human PLA2G7 Diagnostic antigen, Human PLA2G7 diagnostic reagent, LDL-PLA2, LP-PLA2, PAFAD, PAFAH |
| Product Type: | Recombinant protein antigen |
| Product Category: | Cardiac Markers |
| Catalog: | AG10024 |
| Qty/Pack Size: | 100ug, 1mg |
| Format: | Purified Recombinant Antigen. |
| Source: | Human |
| Express Host: | Hek293 Cells |
| Purity: | >95% |
| Supplied In: | 10 mM Phosphate Buffer, 150 mM Sodium Chloride, pH 7.4 |
| Applications: | ELISA, WB, Immunogen, Lateral Flow, CMIA |
| Storage: |
Short Term (≤ 2 weeks): 2-8°C. Long Term: -20°C. Avoid repeated freezing and thawing.
Recombinant proteins are provided as frozen liquid which are shipped with dry ice.
Bulk packages canbeprovided as lyophilized powder which shipped with blue ice. |
| Construction: | A DNA sequence encoding the Human Lp-PLA2 Protein was expressed with His-tag in C terminus. |
| Molecular Mass: | The protein of Human Lp-PLA2 consists of 420 amino acids. |
| Biological Activity: | N/A |
| Endotoxin | N/A |
| Gene ID: | 7941 |
| Gene sequence: | NM_005084.4, Homo sapiens phospholipase A2 group VII (PLA2G7), transcript variant 1, mRNA |
| Protein sequence: | NP_005075.3, platelet-activating factor acetylhydrolase precursor [Homo sapiens] |
| Discription: | Lp-pla2 is synthesized and secreted by mature macrophages and lymphocytes.Under the regulationof inflammatory mediators, phospholipids on OX-LDL-C were hydrolyzed to produce pro-inflammatory substances lyso-PC and Ox-FA. It has the effect of promoting inflammation and atherosclerosis. It is of great significance to the prediction, treatment and prognosis of cardiovascular and cerebrovascular embolic diseases. |
| Sequence: |
MVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQV
LMAAASFGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKE
YFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLY
SAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIR
NEQVRQRAKECSQALSLILDIDHGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGG
ATVIQTLSEDQRFRCGIALDAWMFPLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKC
YSPDKERKMITIRGSVHQNFADFTFATGKIIGHMLKLKGDIDSNVAIDLSNKASLAFL
QKHLGLHKDFDQWDCLIEGDDENLIPGTNINTTNQHIMLQNSSGIEKYNHHHHHH
|
| SDS Page: | -- |
| Note: | This product is intended for research and manufacturing uses only. It is not a diagnostic device. The user assumes all responsibility for care, custody and control of the material, including its disposal, in accordance with all regulations. |
Customers Navigation
PLA2G7 Product Infomation
- Previous：H-FABP Antigen
- Next：D-dimer Antigen