| Product name: | Human IL-6 antigen |
|---|---|
| Synonym: | Human IL-6 Antigen, Human IL-6 recombinant protein, Human IL-6 protein antigen, Human IL-6 Diagnostic antigen, Human IL-6 diagnostic reagent, Human IL6 recombinant protein, Human IL6 protein antigen, Human IL6 Diagnostic antigen, Human IL6 diagnostic reagent, human IL6 Antigen, Human IL6 recombinant protein, Human IL6 protein antigen, Human IL6 Diagnostic antigen, Human IL6 diagnostic reagent, human IL6 Antigen, Human IFN-Beta-2 recombinant protein, Human IFN-Beta-2 protein antigen, Human IFN-Beta-2 Diagnostic antigen, Human IFN-Beta-2 diagnostic reagent, human IFN-Beta-2 Antigen, BSF-2, BSF2, CDF, HGF, HSF, IFN-beta-2,IFNB2,IL-6 antigen |
| Product Type: | Recombinant protein antigen |
| Product Category: | Inflammation and Infection |
| Catalog: | AG10028 |
| Qty/Pack Size: | 100ug, 1mg |
| Format: | Purified Recombinant Antigen. |
| Source: | Human |
| Express Host: | E.coli |
| Purity: | >95% |
| Supplied In: | 10 mM Phosphate Buffer, 150 mM Sodium Chloride, pH 7.4 |
| Applications: | ELISA, WB, Immunogen, Lateral Flow, CMIA, Control |
| Storage: |
Short Term (≤ 2 weeks): 2-8°C. Long Term: -20°C. Avoid repeated freezing and thawing.
Recombinant proteins are provided as frozen liquid which are shipped with dry ice.
Bulk packages canbeprovided as lyophilized powder which shipped with blue ice. |
| Construction: | A DNA sequence encoding the Human IL-6 Protein was expressed with His-tag in N terminus. |
| Molecular Mass: | The protein of Human IL-6 consists of 183 amino acids. |
| Biological Activity: | N/A |
| Endotoxin | N/A |
| Gene ID: | 3569 |
| Gene sequence: | NM_000600.5, Homo sapiens interleukin 6 (IL6), transcript variant 1, mRNA |
| Protein sequence: |
NP_000591.1, interleukin-6 isoform 1 precursor [Homo sapiens]
|
| Discription: | nterleukin 6 (IL-6) is an inflammatory factor and a versatile cytokine with a wide range of functions. After being stimulated by inflammation, the body is secreted by T cells, B cells, monocytes and endothelial cells. It is the key to the inflammatory mediator network. ingredient. After the inflammatoryreaction occurs, IL-6 is produced first, and after production, CRP and procalcitonin (PCT) productionareinduced. Such as acute inflammation during infection, internal and external trauma, surgery, stress response, brain death, tumor development and other conditions will occur quickly. IL-6 is involvedintheoccurrence and development of many diseases. Its blood levels are closely related to inflammation, viral infections, and autoimmune diseases. Its changes are earlier than CRP. |
| Sequence: |
HHHHHHMNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHR
QPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCF
QSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKN
LDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
|
| SDS Page: | -- |
| Note: | This product is intended for research and manufacturing uses only. It is not a diagnostic device. The user assumes all responsibility for care, custody and control of the material, including its disposal, in accordance with all regulations. |
Customers Navigation
IL6 IFNB2 IFN-beta-2 Product Infomation
- Previous：ST2 Antigen
- Next：None