| Product name: | Human SAA antigen |
|---|---|
| Synonym: | Human SAA Antigen, Human SAA recombinant protein, Human SAA protein antigen, Human SAA Diagnostic antigen, Human SAA diagnostic reagent, Human SAA1Antigen, Human SAA1recombinant protein, Human SAA1protein antigen, Human SAA1Diagnostic antigen, Human SAA1diagnostic reagent, PIG4, SAA, SAA2, TP53I4 Antigen |
| Product Type: | Recombinant protein antigen |
| Product Category: | Inflammation and Infection |
| Catalog: | AG10029 |
| Qty/Pack Size: | 100ug, 1mg |
| Format: | Purified Recombinant Antigen. |
| Source: | Human |
| Express Host: | E.coli |
| Purity: | >95% |
| Supplied In: | 10 mM Phosphate Buffer, 150 mM Sodium Chloride, pH 7.4 |
| Applications: | ELISA, WB, Immunogen, Lateral Flow, CMIA, Control |
| Storage: |
Short Term (≤ 2 weeks): 2-8°C. Long Term: -20°C. Avoid repeated freezing and thawing.
Recombinant proteins are provided as frozen liquid which are shipped with dry ice.
Bulk packages canbeprovided as lyophilized powder which shipped with blue ice. |
| Construction: | A DNA sequence encoding the Human SAA Protein was expressed with His-tag in N terminus. |
| Molecular Mass: | The protein of Human SAA consists of 104 amino acids. |
| Biological Activity: | N/A |
| Endotoxin | N/A |
| Gene ID: | 6288 |
| Gene sequence: | NM_000331.6, Homo sapiens serum amyloid A1 (SAA1), transcript variant 1, mRNA |
| Protein sequence: | NP_000322.3, serum amyloid A-1 protein preproprotein [Homo sapiens] |
| Discription: | Serum amyloid (SAA) is the precursor of tissue amyloid A.It's an acute reactive protein produced by liver cells. SAA exists in constant amount in the serum of normal people, but it can increase hundreds tothousands of times in 48-72h during the acute phase of inflammation or infection, and decrease rapidlyduring the recovery phase of disease. SAA is a more sensitive marker for the diagnosis of bacterial or viral infection than CRP. |
| Sequence: |
HHHHHHMKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMRE
ANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANE
WGRSGKDPNHFRPAGLPEKY
|
| SDS Page: | -- |
| Note: | This product is intended for research and manufacturing uses only. It is not a diagnostic device. The user assumes all responsibility for care, custody and control of the material, including its disposal, in accordance with all regulations. |
Customers Navigation
SAA1 Product Infomation
- Previous：IL-6 Antigen
- Next：None