| Product name: | Human PCT antigen |
|---|---|
| Synonym: | Human PCT Antigen, Human PCT recombinant protein, Human PCT protein antigen, Human PCT Diagnostic antigen, Human PCT diagnostic reagent, Human CALCAAntigen, Human CALCArecombinant protein, Human CALCAprotein antigen, Human CALCADiagnostic antigen, Human CALCAdiagnostic reagent, CALC1, CGRP, CGRP-alpha, CGRP-I, CGRP1, CT, KC, PCT antigen |
| Product Type: | Recombinant protein antigen |
| Product Category: | Inflammation and Infection |
| Catalog: | AG10030 |
| Qty/Pack Size: | 100ug, 1mg |
| Format: | Purified Recombinant Antigen. |
| Source: | Human |
| Express Host: | E.coli |
| Purity: | >95% |
| Supplied In: | 10 mM Phosphate Buffer, 150 mM Sodium Chloride, pH 7.4 |
| Applications: | ELISA, WB, Immunogen, Lateral Flow, CMIA, Control |
| Storage: |
Short Term (≤ 2 weeks): 2-8°C. Long Term: -20°C. Avoid repeated freezing and thawing.
Recombinant proteins are provided as frozen liquid which are shipped with dry ice.
Bulk packages canbeprovided as lyophilized powder which shipped with blue ice. |
| Construction: | A DNA sequence encoding the Human PCT Protein was expressed with His-tag in C terminus. |
| Molecular Mass: | The protein of Human PCT consists of 116 amino acids. |
| Biological Activity: | N/A |
| Endotoxin | N/A |
| Gene ID: | 796 |
| Gene sequence: | NM_001741.3, Homo sapiens calcitonin related polypeptide alpha (CALCA), transcript variant 1, mRNA |
| Protein sequence: | NP_001732.1, calcitonin isoform CT preproprotein [Homo sapiens] |
| Discription: | Procalcitonin (PCT) is a precursor peptide of the hormone calcitonin (CT). The content of PCT in the serumof normal people is very low. After being infected by microorganisms, calC-I gene is induced to express and promote the secretion of PCT, reaching the peak at 8 hours.PCT has been recognized as a marker of systemic inflammatory response syndrome to guide treatment, reduce antibiotic use, diagnose sepsis, and improve long-term outcomes. |
| Sequence: |
MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSE
DEARLLLAALVQDYVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNK
FHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNANHHHHHH
|
| SDS Page: | -- |
| Note: | This product is intended for research and manufacturing uses only. It is not a diagnostic device. The user assumes all responsibility for care, custody and control of the material, including its disposal, in accordance with all regulations. |
Customers Navigation
CALCA Product Infomation
- Previous：SAA Antigen
- Next：None