| Product name: | Human HBP antigen |
|---|---|
| Synonym: | Human HBP Antigen, Human HBP recombinant protein, Human HBP protein antigen, Human HBP Diagnostic antigen, Human HBP diagnostic reagent, Human AZU1 Antigen, Human AZU1 recombinant protein, Human AZU1 protein antigen, Human AZU1 Diagnostic antigen, Human AZU1 diagnostic reagent, AZAMP, AZU, CAP37, HBP, hHBP, HUMAZUR, cationic antimicrobial protein 37, heparin-binding protein, neutrophil azurocidin, cationic antimicrobial protein CAP37 Antigen |
| Product Type: | Recombinant protein antigen |
| Product Category: | Inflammation and Infection |
| Catalog: | AG10031 |
| Qty/Pack Size: | 100ug, 1mg |
| Format: | Purified Recombinant Antigen. |
| Source: | Human |
| Express Host: | Hek293 Cells |
| Purity: | >95% |
| Supplied In: | 10 mM Phosphate Buffer, 150 mM Sodium Chloride, pH 7.4 |
| Applications: | ELISA, WB, Immunogen, Lateral Flow, CMIA, Control |
| Storage: |
Short Term (≤ 2 weeks): 2-8°C. Long Term: -20°C. Avoid repeated freezing and thawing.
Recombinant proteins are provided as frozen liquid which are shipped with dry ice.
Bulk packages canbeprovided as lyophilized powder which shipped with blue ice. |
| Construction: | A DNA sequence encoding the Human HBP Protein was expressed with His-tag in C terminus. |
| Molecular Mass: | The protein of Human HBP consists of 229 amino acids. |
| Biological Activity: | N/A |
| Endotoxin | N/A |
| Gene ID: | 566 |
| Gene sequence: | NM_001700.5, Homo sapiens azurocidin 1 (AZU1), mRNA |
| Protein sequence: | NP_001691.1, azurocidin preproprotein [Homo sapiens] |
| Discription: | Heparin-binding protein (HBP), also known as Azurocidin or cationic antibacterial protein (CAP37), is amultifunctional protein with bactericidal function and chemotactic characteristics, mainly existing insecretory granules and Azurocidin granules of neutrophils. Heparin binding protein is the earliest marker of bacterial infection. When infection occurs, bacteria invade into blood vessels and stimulate neutrophilsto release HBP, which increases plasma HBP content. |
| Sequence: |
MTRLTVLALLAGLLASSRAGSSPLLDIVGGRKARPRQFPFLASI
QNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSM
SENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSG
GRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFS
LGPCGRGPDFFTRVALFRDWIDGVLNNPGPGPAHHHHHH
|
| SDS Page: | -- |
| Note: | This product is intended for research and manufacturing uses only. It is not a diagnostic device. The user assumes all responsibility for care, custody and control of the material, including its disposal, in accordance with all regulations. |
Customers Navigation
AZU1 Product Infomation
- Previous：PCT Antigen
- Next：None