| Product name: | Human RBP4 antigen |
|---|---|
| Synonym: | Human RBP4 Antigen, Human RBP4 recombinant protein, Human RBP4 protein antigen, Human RBP4 Diagnostic antigen, Human RBP4 diagnostic reagent, MCOPCB10, RDCCAS, retinol-binding protein 4, interstitial, RBP, PRBP, plasma retinol-binding protein; retinol binding protein 4, plasma Antigen |
| Product Type: | Recombinant protein antigen |
| Product Category: | Renal Function |
| Catalog: | AG10032 |
| Qty/Pack Size: | 100ug, 1mg |
| Format: | Purified Recombinant Antigen. |
| Source: | Human |
| Express Host: | Hek293 Cells |
| Purity: | >95% |
| Supplied In: | 10 mM Phosphate Buffer, 150 mM Sodium Chloride, pH 7.4 |
| Applications: | ELISA, WB, Immunogen, Lateral Flow, CMIA, Control |
| Storage: |
Short Term (≤ 2 weeks): 2-8°C. Long Term: -20°C. Avoid repeated freezing and thawing.
Recombinant proteins are provided as frozen liquid which are shipped with dry ice.
Bulk packages canbeprovided as lyophilized powder which shipped with blue ice. |
| Construction: | A DNA sequence encoding the Human RBP4 Protein was expressed with His-tag in C terminus. |
| Molecular Mass: | The protein of Human RBP4 consists of 183 amino acids. |
| Biological Activity: | N/A |
| Endotoxin | N/A |
| Gene ID: | 5950 |
| Gene sequence: |
NM_006744.4, Homo sapiens retinol binding protein 4 (RBP4), transcript variant 1, mRNA
|
| Protein sequence: | NP_006735.2, retinol-binding protein 4 isoform a precursor [Homo sapiens] |
| Discription: | RBP4 is a retinol carrier in blood, a 21kD protein belonging to the lipid carrier protein family and containingaretinol binding site.Fat, kidney, testis, brain and digestive tract can synthesize and secrete RBP4, but themainsource of this protein under normal physiological conditions is the liver.RBP4 can be used as a diagnosticindex reflecting kidney and liver injury. |
| Sequence: |
MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYA
MAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPA
KFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPN
GLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLLHHHHHH
|
| SDS Page: | -- |
| Note: | This product is intended for research and manufacturing uses only. It is not a diagnostic device. The user assumes all responsibility for care, custody and control of the material, including its disposal, in accordance with all regulations. |
Customers Navigation
Retinol Binding Protein 4 MCOPCB10 Product Infomation
- Previous：HBP Antigen
- Next：None